Online tool for moving species name in FASTA-format BLAST-output to front


When making a phylogenetic tree from genetic data, sometimes the species name gets cut off, like this:

(insert image here)

The solution would be to automatically move the species name to the front, instead of the identifier. That is exactly what this script does.

Some sample data:

>gi|298708956|emb|CBJ30909.1|:1-285 aureochrome 4 [Ectocarpus siliculosus]
MKRELSDSNLAGAADWGGRNDMGWGGLGGDARRSMSEQQKLERRERNREHAKRSRIRKKFMLECLQEQLLAMRKQNLALR
QVVKEHMPDEASTVFEKCINEKALVLSGKSTESAQPILSDDEEETKEPNCLLLEPDFQLMQALMTSQQNFTISDPSMPDN
>gi|1001011761|gb|AML76384.1|:122-405 putative LOV domain-containing protein [Punctaria latifolia]
MKRELSDSNLGGAAGWDGNDSGWAGMGGDARRSMSEQQKLERRERNREHAKRSRIRKKFMLECLQEQLLAMRKQNLALRQ
VVKEHMPDEAATVFEKCINEKALVLSGKSTESAQPILSDDEDETKEPNCLLLEPDFQLMQALMASQQNFTISDPSMPDNP